Class a: All alpha proteins [46456] (289 folds) |
Fold a.293: SMc04008-like [158756] (1 superfamily) multihelcal; intertwined homodimer; there are 4 core helices in each subunits; contains putative metal ion-binding motif MxxxxxCxxC in the conserved surface site |
Superfamily a.293.1: SMc04008-like [158757] (2 families) |
Family a.293.1.0: automated matches [227238] (1 protein) not a true family |
Protein automated matches [226996] (1 species) not a true protein |
Species Alcanivorax borkumensis [TaxId:393595] [225608] (1 PDB entry) |
Domain d3fyba1: 3fyb A:1-97 [210251] Other proteins in same PDB: d3fyba2, d3fybb2 automated match to d2o35a1 complexed with ca, cl, edo, peg |
PDB Entry: 3fyb (more details), 1.8 Å
SCOPe Domain Sequences for d3fyba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fyba1 a.293.1.0 (A:1-97) automated matches {Alcanivorax borkumensis [TaxId: 393595]} madidqasktemeaaafrhllrhldehkdvqnidlmiqadfcrnclakwlmeaateqgve ldydgareyvygmpfaewktlyqkpaseaqlaafeak
Timeline for d3fyba1: