Lineage for d3fwrb_ (3fwr B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409742Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1409743Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1409900Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 1409901Protein automated matches [191100] (10 species)
    not a true protein
  7. 1409904Species Bacillus subtilis [TaxId:1423] [196484] (3 PDB entries)
  8. 1409910Domain d3fwrb_: 3fwr B: [210248]
    automated match to d3fwsb_
    complexed with adp

Details for d3fwrb_

PDB Entry: 3fwr (more details), 2.45 Å

PDB Description: Crystal Structure of the CBS domains from the Bacillus subtilis CcpN repressor complexed with ADP
PDB Compounds: (B:) YqzB protein

SCOPe Domain Sequences for d3fwrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fwrb_ d.37.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
gktgtqlladklkklqvkdfqsipvvihenvsvydaictmfledvgtlfvvdrdavlvgv
lsrkdllrasigqqeltsvpvhiimtrmpnitvcrredyvmdiakhliekqidalpvikd
tdkgfevigrvtktnmtkilvslsen

SCOPe Domain Coordinates for d3fwrb_:

Click to download the PDB-style file with coordinates for d3fwrb_.
(The format of our PDB-style files is described here.)

Timeline for d3fwrb_: