| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
| Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
| Protein automated matches [191100] (15 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [196484] (3 PDB entries) |
| Domain d3fwra_: 3fwr A: [210247] automated match to d3fwsb_ complexed with adp |
PDB Entry: 3fwr (more details), 2.45 Å
SCOPe Domain Sequences for d3fwra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fwra_ d.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
tqlladklkklqvkdfqsipvvihenvsvydaictmfledvgtlfvvdrdavlvgvlsrk
dllrasigqqeltsvpvhiimtrmpnitvcrredyvmdiakhliekqidalpvikdtdkg
fevigrvtktnmtkilvslseneil
Timeline for d3fwra_: