SCOPe 2.07: Domain d3fwna2: 3fwn A:177-468

Lineage for d3fwna2 (3fwn A:177-468)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (37 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225711] (3 PDB entries)

8. Domain d3fwna2: 3fwn A:177-468 [210244]
   Other proteins in same PDB: d3fwna1, d3fwnb1
   automated match to d1pgja1
   complexed with 6pg, atr

Details for d3fwna2

PDB Entry: 3fwn, 1.5 Å

PDB Description: dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d3fwna2:

Sequence; same for both SEQRES and ATOM records:

>d3fwna2 a.100.1.0 (A:177-468) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gaghyvkmvhngieygdmqliaeaysllkgglnltneelaqtftewnngelssyliditk
diftkkdedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfaryisslkdqr
vaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeynwdlnygei
akifragciiraqflqkitdayaenpqianlllapyfkqiaddyqqalrdvvayavqigi
pvptfsaavayydsyraavlpanliqaqrdyfgahtykridkegvfhtewld

Timeline for d3fwna2:

• d3fwna2 first appeared in SCOPe 2.03
  
• d3fwna2 appears in SCOPe 2.06