Lineage for d1cicd2 (1cic D:117-218)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53716Species Fab D1.3 (mouse), kappa L chain [49005] (2 PDB entries)
  8. 53720Domain d1cicd2: 1cic D:117-218 [21023]
    Other proteins in same PDB: d1cica1, d1cicb1, d1cicc1, d1cicd1

Details for d1cicd2

PDB Entry: 1cic (more details), 2.5 Å

PDB Description: idiotope-anti-idiotope fab-fab complex; d1.3-e225

SCOP Domain Sequences for d1cicd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cicd2 b.1.1.2 (D:117-218) Immunoglobulin (constant domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
asttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1cicd2:

Click to download the PDB-style file with coordinates for d1cicd2.
(The format of our PDB-style files is described here.)

Timeline for d1cicd2: