SCOPe 2.03: Domain d3fvfb_: 3fvf B:

Lineage for d3fvfb_ (3fvf B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187421] (33 PDB entries)

8. Domain d3fvfb_: 3fvf B: [210218]
   automated match to d3v7ta_
   complexed with 1jz, dms, gol

Details for d3fvfb_

PDB Entry: 3fvf, 1.6 Å

PDB Description: the crystal structure of prostasin complexed with camostat at 1.6 angstroms resolution

PDB Compounds: (B:) Prostasin

SCOPe Domain Sequences for d3fvfb_:

Sequence; same for both SEQRES and ATOM records:

>d3fvfb_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itggssavagqwpwqvsityegvhvcggslvseqwvlsaahcfpsehhkeayevklgahq
ldsysedakvstlkdiiphpsylqegsqgdiallqlsrpitfsryirpislpaaqasfpn
glhctvtgwghvapsvslltpkplqqlevplisretcnslynidakpeephfvqedmvca
gyveggkdacqgdsggplscpveglwyltgivswgdacgarnrpgvytlassyaswiqsk
vtelqprv

Timeline for d3fvfb_:

• d3fvfb_ is new in SCOPe 2.03-stable
  
• d3fvfb_ appears in SCOPe 2.04
  
• d3fvfb_ appears in the current release, SCOPe 2.08