![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Brucella melitensis [TaxId:359391] [225607] (1 PDB entry) |
![]() | Domain d3fvba1: 3fvb A:1-159 [210216] Other proteins in same PDB: d3fvba2, d3fvbb2 automated match to d1jgca_ complexed with cl, fe, hem, imd, mg, na |
PDB Entry: 3fvb (more details), 1.81 Å
SCOPe Domain Sequences for d3fvba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fvba1 a.25.1.0 (A:1-159) automated matches {Brucella melitensis [TaxId: 359391]} mkgepkvierlnealflelgavnqywlhyrllndwgytrlakkereesieemhhadklid riiflegfpnlqtvsplrigqnvkevleadlkgeydarasykesreicdklgdyvskqlf delladeeghidfletqldllakiggerygqlnaapade
Timeline for d3fvba1: