Lineage for d3fv9g1 (3fv9 G:2-127)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948495Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries)
  8. 2948502Domain d3fv9g1: 3fv9 G:2-127 [210212]
    Other proteins in same PDB: d3fv9a2, d3fv9a3, d3fv9b2, d3fv9b3, d3fv9c2, d3fv9c3, d3fv9d2, d3fv9d3, d3fv9e2, d3fv9e3, d3fv9f2, d3fv9f3, d3fv9g2, d3fv9g3, d3fv9h2, d3fv9h3
    automated match to d1jpma2
    complexed with mg

Details for d3fv9g1

PDB Entry: 3fv9 (more details), 1.9 Å

PDB Description: crystal structure of putative mandelate racemase/muconatelactonizing enzyme from roseovarius nubinhibens ism complexed with magnesium
PDB Compounds: (G:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3fv9g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fv9g1 d.54.1.0 (G:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
kitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaah
aggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglpl
cdmtgg

SCOPe Domain Coordinates for d3fv9g1:

Click to download the PDB-style file with coordinates for d3fv9g1.
(The format of our PDB-style files is described here.)

Timeline for d3fv9g1: