Lineage for d3fv9e2 (3fv9 E:128-373)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1823470Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1823858Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1823859Protein automated matches [226923] (71 species)
    not a true protein
  7. 1824303Species Roseovarius nubinhibens [TaxId:89187] [225251] (5 PDB entries)
  8. 1824308Domain d3fv9e2: 3fv9 E:128-373 [210209]
    Other proteins in same PDB: d3fv9a1, d3fv9b1, d3fv9c1, d3fv9d1, d3fv9e1, d3fv9f1, d3fv9g1, d3fv9h1
    automated match to d1jpma1
    complexed with mg

Details for d3fv9e2

PDB Entry: 3fv9 (more details), 1.9 Å

PDB Description: crystal structure of putative mandelate racemase/muconatelactonizing enzyme from roseovarius nubinhibens ism complexed with magnesium
PDB Compounds: (E:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3fv9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fv9e2 c.1.11.0 (E:128-373) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
rvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldaeritacla
drqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarcalpllld
eliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdtvgsqisf
aailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrvnrdalgt
pvktfg

SCOPe Domain Coordinates for d3fv9e2:

Click to download the PDB-style file with coordinates for d3fv9e2.
(The format of our PDB-style files is described here.)

Timeline for d3fv9e2: