Lineage for d1fdll2 (1fdl L:108-214)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8891Species Fab D1.3 (mouse), kappa L chain [49005] (2 PDB entries)
  8. 8893Domain d1fdll2: 1fdl L:108-214 [21020]
    Other proteins in same PDB: d1fdlh1, d1fdll1, d1fdly_

Details for d1fdll2

PDB Entry: 1fdl (more details), 2.5 Å

PDB Description: crystallographic refinement of the three-dimensional structure of the fab d1.3-lysozyme complex at 2.5-angstroms resolution

SCOP Domain Sequences for d1fdll2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdll2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1fdll2:

Click to download the PDB-style file with coordinates for d1fdll2.
(The format of our PDB-style files is described here.)

Timeline for d1fdll2: