Lineage for d3fv6a_ (3fv6 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550319Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2550320Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2550519Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 2550520Protein automated matches [191100] (15 species)
    not a true protein
  7. 2550528Species Bacillus subtilis [TaxId:1423] [196484] (3 PDB entries)
  8. 2550529Domain d3fv6a_: 3fv6 A: [210197]
    automated match to d3fwsb_

Details for d3fv6a_

PDB Entry: 3fv6 (more details), 1.95 Å

PDB Description: Crystal Structure of the CBS domains from the Bacillus subtilis CcpN repressor
PDB Compounds: (A:) YqzB protein

SCOPe Domain Sequences for d3fv6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fv6a_ d.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
tqlladklkklqvkdfqsipvvihenvsvydaictmfledvgtlfvvdrdavlvgvlsrk
dllrasigqqeltsvpvhiimtrmpnitvcrredyvmdiakhliekqidalpvikdtdkg
fevigrvtktnmtkilvslseneil

SCOPe Domain Coordinates for d3fv6a_:

Click to download the PDB-style file with coordinates for d3fv6a_.
(The format of our PDB-style files is described here.)

Timeline for d3fv6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3fv6b_