SCOPe 2.07: Domain d3fv6a_: 3fv6 A:

Lineage for d3fv6a_ (3fv6 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (15 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [196484] (3 PDB entries)

8. Domain d3fv6a_: 3fv6 A: [210197]
   automated match to d3fwsb_

Details for d3fv6a_

PDB Entry: 3fv6, 1.95 Å

PDB Description: Crystal Structure of the CBS domains from the Bacillus subtilis CcpN repressor

PDB Compounds: (A:) YqzB protein

SCOPe Domain Sequences for d3fv6a_:

Sequence; same for both SEQRES and ATOM records:

>d3fv6a_ d.37.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
tqlladklkklqvkdfqsipvvihenvsvydaictmfledvgtlfvvdrdavlvgvlsrk
dllrasigqqeltsvpvhiimtrmpnitvcrredyvmdiakhliekqidalpvikdtdkg
fevigrvtktnmtkilvslseneil

Timeline for d3fv6a_:

• d3fv6a_ first appeared in SCOPe 2.03
  
• d3fv6a_ appears in SCOPe 2.06
  
• d3fv6a_ appears in the current release, SCOPe 2.08