Lineage for d3fv5b_ (3fv5 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1429695Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1429696Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1430131Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1430132Protein automated matches [226867] (10 species)
    not a true protein
  7. 1430153Species Escherichia coli [TaxId:83333] [225819] (2 PDB entries)
  8. 1430155Domain d3fv5b_: 3fv5 B: [210196]
    automated match to d1aj6a_
    complexed with 1eu

Details for d3fv5b_

PDB Entry: 3fv5 (more details), 1.8 Å

PDB Description: Crystal Structure of E. coli Topoisomerase IV co-complexed with inhibitor
PDB Compounds: (B:) DNA topoisomerase 4 subunit B

SCOPe Domain Sequences for d3fv5b_:

Sequence, based on SEQRES records: (download)

>d3fv5b_ d.122.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
glepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrgm
pvdihpeegvpavelilcrlhaggkfsnknyqfsgglhgvgisvvnalskrvevnvrrdg
qvyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfsvsrlthvlkakavl
cpgveitfkdeinnteqrwcy

Sequence, based on observed residues (ATOM records): (download)

>d3fv5b_ d.122.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
glepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrgm
pvdihpeegvpavelilcrlgisvvnalskrvevnvrrdgqvyniafengekvqdlqvvg
tcgkrntgtsvhfwpdetffdsprfsvsrlthvlkakavlcpgveitfkdeinnteqrwc
y

SCOPe Domain Coordinates for d3fv5b_:

Click to download the PDB-style file with coordinates for d3fv5b_.
(The format of our PDB-style files is described here.)

Timeline for d3fv5b_: