![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
![]() | Protein automated matches [226867] (10 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [225819] (2 PDB entries) |
![]() | Domain d3fv5b_: 3fv5 B: [210196] automated match to d1aj6a_ complexed with 1eu |
PDB Entry: 3fv5 (more details), 1.8 Å
SCOPe Domain Sequences for d3fv5b_:
Sequence, based on SEQRES records: (download)
>d3fv5b_ d.122.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]} glepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrgm pvdihpeegvpavelilcrlhaggkfsnknyqfsgglhgvgisvvnalskrvevnvrrdg qvyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfsvsrlthvlkakavl cpgveitfkdeinnteqrwcy
>d3fv5b_ d.122.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]} glepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrgm pvdihpeegvpavelilcrlgisvvnalskrvevnvrrdgqvyniafengekvqdlqvvg tcgkrntgtsvhfwpdetffdsprfsvsrlthvlkakavlcpgveitfkdeinnteqrwc y
Timeline for d3fv5b_: