SCOPe 2.03: Domain d3fv5b_: 3fv5 B:

Lineage for d3fv5b_ (3fv5 B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [225819] (2 PDB entries)

8. Domain d3fv5b_: 3fv5 B: [210196]
   automated match to d1aj6a_
   complexed with 1eu

Details for d3fv5b_

PDB Entry: 3fv5, 1.8 Å

PDB Description: Crystal Structure of E. coli Topoisomerase IV co-complexed with inhibitor

PDB Compounds: (B:) DNA topoisomerase 4 subunit B

SCOPe Domain Sequences for d3fv5b_:

Sequence, based on SEQRES records:

>d3fv5b_ d.122.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
glepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrgm
pvdihpeegvpavelilcrlhaggkfsnknyqfsgglhgvgisvvnalskrvevnvrrdg
qvyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfsvsrlthvlkakavl
cpgveitfkdeinnteqrwcy

Sequence, based on observed residues (ATOM records):

>d3fv5b_ d.122.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
glepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadqsleviddgrgm
pvdihpeegvpavelilcrlgisvvnalskrvevnvrrdgqvyniafengekvqdlqvvg
tcgkrntgtsvhfwpdetffdsprfsvsrlthvlkakavlcpgveitfkdeinnteqrwc
y

Timeline for d3fv5b_:

• d3fv5b_ is new in SCOPe 2.03-stable
  
• d3fv5b_ appears in SCOPe 2.04
  
• d3fv5b_ appears in the current release, SCOPe 2.08