SCOPe 2.08: Domain d3fv2b_: 3fv2 B:

Lineage for d3fv2b_ (3fv2 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries)

8. Domain d3fv2b_: 3fv2 B: [210194]
   automated match to d2znta_
   complexed with gol, ndz, so4

Details for d3fv2b_

PDB Entry: 3fv2, 1.5 Å

PDB Description: crystal structure of the human glutamate receptor, glur5, ligand- binding core in complex with neodysiherbaine a in space group p1

PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 1

SCOPe Domain Sequences for d3fv2b_:

Sequence; same for both SEQRES and ATOM records:

>d3fv2b_ c.94.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
anrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgfiydvklvpdgky
gaqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpid
saddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqtalvrnsdegiqrvl
ttdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeeg
klhmmkekwwrgngcp

Timeline for d3fv2b_:

• d3fv2b_ first appeared in SCOPe 2.03
  
• d3fv2b_ appears in SCOPe 2.07