Lineage for d3fv2a_ (3fv2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915586Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries)
  8. 2915594Domain d3fv2a_: 3fv2 A: [210193]
    automated match to d2znta_
    complexed with gol, ndz, so4

Details for d3fv2a_

PDB Entry: 3fv2 (more details), 1.5 Å

PDB Description: crystal structure of the human glutamate receptor, glur5, ligand- binding core in complex with neodysiherbaine a in space group p1
PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 1

SCOPe Domain Sequences for d3fv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fv2a_ c.94.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
anrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgfiydvklvpdgky
gaqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpid
saddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqtalvrnsdegiqrvl
ttdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeeg
klhmmkekwwrgngcp

SCOPe Domain Coordinates for d3fv2a_:

Click to download the PDB-style file with coordinates for d3fv2a_.
(The format of our PDB-style files is described here.)

Timeline for d3fv2a_: