SCOP 1.67: Domain d1frgh2: 1frg H:337-437

Lineage for d1frgh2 (1frg H:337-437)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d1frgh2: 1frg H:337-437 [21019]
   Other proteins in same PDB: d1frgh1, d1frgl1, d1frgl2
   part of Fab 26/9
   complexed with nh2

Details for d1frgh2

PDB Entry: 1frg, 2.8 Å

PDB Description: crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody fab 26(slash)9: fine-tuning antibody specificity

SCOP Domain Sequences for d1frgh2:

Sequence; same for both SEQRES and ATOM records:

>d1frgh2 b.1.1.2 (H:337-437) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
aakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1frgh2:

• d1frgh2 first appeared (with stable ids) in SCOP 1.55
  
• d1frgh2 appears in SCOP 1.65
  
• d1frgh2 appears in SCOP 1.69
  
• d1frgh2 appears in the current release, SCOPe 2.08