Lineage for d3fuxa_ (3fux A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865706Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1865707Protein automated matches [190689] (49 species)
    not a true protein
  7. 1865995Species Thermus thermophilus HB8 [TaxId:300852] [225633] (5 PDB entries)
  8. 1866000Domain d3fuxa_: 3fux A: [210186]
    automated match to d3tpzb_
    protein/RNA complex; complexed with mta

Details for d3fuxa_

PDB Entry: 3fux (more details), 1.68 Å

PDB Description: t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in complex with 5'-methylthioadenosine in space group p212121
PDB Compounds: (A:) Dimethyladenosine transferase

SCOPe Domain Sequences for d3fuxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fuxa_ c.66.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
aspqsvrallerhglfadkrfgqnflvseahlrriveaarpftgpvfevgpglgaltral
leagaevtaiekdlrlrpvleetlsglpvrlvfqdallypweevpqgsllvanlpyhiat
plvtrllktgrfarlvflvqkevaermtarpktpaygvltlrvahhavaerlfdlppgaf
fpppkvwsslvrltptgalddpglfrlveaafgkrrktllnalaaagypkarveealral
glpprvraeeldleafrrlregle

SCOPe Domain Coordinates for d3fuxa_:

Click to download the PDB-style file with coordinates for d3fuxa_.
(The format of our PDB-style files is described here.)

Timeline for d3fuxa_: