Lineage for d1frgl2 (1frg L:114-217)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53511Species Fab 26/9 (mouse), kappa L chain [49004] (1 PDB entry)
  8. 53513Domain d1frgl2: 1frg L:114-217 [21018]
    Other proteins in same PDB: d1frgh1, d1frgl1

Details for d1frgl2

PDB Entry: 1frg (more details), 2.8 Å

PDB Description: crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody fab 26(slash)9: fine-tuning antibody specificity

SCOP Domain Sequences for d1frgl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frgl2 b.1.1.2 (L:114-217) Immunoglobulin (constant domains of L and H chains) {Fab 26/9 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1frgl2:

Click to download the PDB-style file with coordinates for d1frgl2.
(The format of our PDB-style files is described here.)

Timeline for d1frgl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1frgl1