SCOPe 2.08: Domain d3fuma1: 3fum A:5-208

Lineage for d3fuma1 (3fum A:5-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)

6. Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63740] (58 PDB entries)
   Uniprot P09960

8. Domain d3fuma1: 3fum A:5-208 [210173]
   Other proteins in same PDB: d3fuma2, d3fuma3
   automated match to d1hs6a2
   complexed with 80a, act, imd, yb, zn

Details for d3fuma1

PDB Entry: 3fum, 2.15 Å

PDB Description: leukotriene a4 hydrolase in complex with (r)-pyridin-4-yl[4-(2- pyrrolidin-1-ylethoxy)phenyl]methanol

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3fuma1:

Sequence; same for both SEQRES and ATOM records:

>d3fuma1 b.98.1.1 (A:5-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiekv
vingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqts
gkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdpedp
srkiykfiqkvpipcylialvvga

Timeline for d3fuma1:

• d3fuma1 first appeared in SCOPe 2.03
  
• d3fuma1 appears in SCOPe 2.07