Lineage for d3fula1 (3ful A:5-208)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1333802Fold b.98: Leukotriene A4 hydrolase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 1333803Superfamily b.98.1: Leukotriene A4 hydrolase N-terminal domain [63737] (1 family) (S)
  5. 1333804Family b.98.1.1: Leukotriene A4 hydrolase N-terminal domain [63738] (1 protein)
  6. 1333805Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 1333806Species Human (Homo sapiens) [TaxId:9606] [63740] (44 PDB entries)
    Uniprot P09960
  8. 1333847Domain d3fula1: 3ful A:5-208 [210170]
    Other proteins in same PDB: d3fula2, d3fula3
    automated match to d1hs6a2
    complexed with 52d, imd, yb, zn

Details for d3fula1

PDB Entry: 3ful (more details), 2.39 Å

PDB Description: leukotriene a4 hydrolase in complex with pyridin-4-yl[4-(2-pyrrolidin- 1-ylethoxy)phenyl]methanone
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3fula1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fula1 b.98.1.1 (A:5-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiekv
vingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqts
gkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdpedp
srkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d3fula1:

Click to download the PDB-style file with coordinates for d3fula1.
(The format of our PDB-style files is described here.)

Timeline for d3fula1: