SCOPe 2.06: Domain d3fuia3: 3fui A:461-610

Lineage for d3fuia3 (3fui A:461-610)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
   automatically mapped to Pfam PF09127
   this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain

6. Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63610] (56 PDB entries)
   Uniprot P09960

8. Domain d3fuia3: 3fui A:461-610 [210163]
   Other proteins in same PDB: d3fuia1, d3fuia2
   automated match to d1hs6a1
   complexed with 812, imd, yb, zn

Details for d3fuia3

PDB Entry: 3fui, 2.2 Å

PDB Description: leukotriene a4 hydrolase in complex with n-benzyl-4-[(2r)-pyrrolidin- 2-ylmethoxy]aniline

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3fuia3:

Sequence; same for both SEQRES and ATOM records:

>d3fuia3 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

Timeline for d3fuia3:

• d3fuia3 first appeared in SCOPe 2.03
  
• d3fuia3 appears in SCOPe 2.05
  
• d3fuia3 appears in SCOPe 2.07
  
• d3fuia3 appears in the current release, SCOPe 2.08