SCOP 1.61: Domain d1cgsh2: 1cgs H:118-214

Lineage for d1cgsh2 (1cgs H:118-214)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab, anti-sweetener (mouse), kappa L chain [49002] (2 PDB entries)

8. Domain d1cgsh2: 1cgs H:118-214 [21015]
   Other proteins in same PDB: d1cgsh1, d1cgsl1

Details for d1cgsh2

PDB Entry: 1cgs, 2.6 Å

PDB Description: local and transmitted conformational changes on complexation of an anti-sweetener fab

SCOP Domain Sequences for d1cgsh2:

Sequence; same for both SEQRES and ATOM records:

>d1cgsh2 b.1.1.2 (H:118-214) Immunoglobulin (constant domains of L and H chains) {Fab, anti-sweetener (mouse), kappa L chain}
kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
ytmsssvtvpsstwpsqtvtcsvahpassttvdkkle

Timeline for d1cgsh2:

• d1cgsh2 first appeared (with stable ids) in SCOP 1.55
  
• d1cgsh2 appears in SCOP 1.59
  
• d1cgsh2 appears in SCOP 1.63
  
• d1cgsh2 appears in the current release, SCOPe 2.08