Class b: All beta proteins [48724] (174 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Laccase [49557] (5 species) consists of three domains of this fold |
Species Fungus (Melanocarpus albomyces) [TaxId:204285] [74873] (8 PDB entries) |
Domain d3fu9a1: 3fu9 A:1-162 [210143] automated match to d1gw0a1 complexed with cl, cu, kib, nag, so4 |
PDB Entry: 3fu9 (more details), 2 Å
SCOPe Domain Sequences for d3fu9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fu9a1 b.6.1.3 (A:1-162) Laccase {Fungus (Melanocarpus albomyces) [TaxId: 204285]} eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslp
Timeline for d3fu9a1: