Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Laccase, C-terminal domain [418907] (5 species) |
Species Fungus (Melanocarpus albomyces) [TaxId:204285] [419309] (9 PDB entries) |
Domain d3fu7b3: 3fu7 B:344-559 [210136] Other proteins in same PDB: d3fu7a1, d3fu7a2, d3fu7b1, d3fu7b2 automated match to d1gw0a3 complexed with 3dm, cl, cu, d2m, kia, nag, oxy, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3fu7 (more details), 1.67 Å
SCOPe Domain Sequences for d3fu7b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fu7b3 b.6.1.3 (B:344-559) Laccase, C-terminal domain {Fungus (Melanocarpus albomyces) [TaxId: 204285]} rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad lrqrisqededdfnrvcdewraywptnpypkidsgl
Timeline for d3fu7b3: