Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Fab, anti-sweetener (mouse), kappa L chain [49002] (2 PDB entries) |
Domain d2cgrh2: 2cgr H:118-214 [21013] Other proteins in same PDB: d2cgrh1, d2cgrl1 |
PDB Entry: 2cgr (more details), 2.2 Å
SCOP Domain Sequences for d2cgrh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cgrh2 b.1.1.2 (H:118-214) Immunoglobulin (constant domains of L and H chains) {Fab, anti-sweetener (mouse), kappa L chain} kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl ytmsssvtvpsstwpsqtvtcsvahpassttvdkkle
Timeline for d2cgrh2: