![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein) automatically mapped to Pfam PF09127 this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain |
![]() | Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63610] (58 PDB entries) Uniprot P09960 |
![]() | Domain d3fu0a3: 3fu0 A:461-610 [210121] Other proteins in same PDB: d3fu0a1, d3fu0a2 automated match to d1hs6a1 complexed with 22f, act, imd, yb, zn |
PDB Entry: 3fu0 (more details), 1.8 Å
SCOPe Domain Sequences for d3fu0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fu0a3 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks hdqavrtyqehkasmhpvtamlvgkdlkvd
Timeline for d3fu0a3: