SCOP 1.65: Domain d2cgrl2: 2cgr L:113-219

Lineage for d2cgrl2 (2cgr L:113-219)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)

8. Domain d2cgrl2: 2cgr L:113-219 [21012]
   Other proteins in same PDB: d2cgrh1, d2cgrh2, d2cgrl1
   part of an anti-sweetener Fab
   complexed with gas

Details for d2cgrl2

PDB Entry: 2cgr, 2.2 Å

PDB Description: local and transmitted conformational changes on complexation of an anti-sweetener fab

SCOP Domain Sequences for d2cgrl2:

Sequence; same for both SEQRES and ATOM records:

>d2cgrl2 b.1.1.2 (L:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2cgrl2:

• d2cgrl2 first appeared (with stable ids) in SCOP 1.55
  
• d2cgrl2 appears in SCOP 1.63
  
• d2cgrl2 appears in SCOP 1.67
  
• d2cgrl2 appears in the current release, SCOPe 2.08