SCOPe 2.05: Domain d3ftza1: 3ftz A:4-208

Lineage for d3ftza1 (3ftz A:4-208)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)

6. Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63740] (45 PDB entries)
   Uniprot P09960

8. Domain d3ftza1: 3ftz A:4-208 [210116]
   Other proteins in same PDB: d3ftza2, d3ftza3
   automated match to d1hs6a2
   complexed with 848, act, imd, yb, zn

Details for d3ftza1

PDB Entry: 3ftz, 2 Å

PDB Description: Leukotriene A4 hydrolase in complex with fragment 2-(pyridin-3-ylmethoxy)aniline

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3ftza1:

Sequence; same for both SEQRES and ATOM records:

>d3ftza1 b.98.1.1 (A:4-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek
vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt
sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped
psrkiykfiqkvpipcylialvvga

Timeline for d3ftza1:

• d3ftza1 first appeared in SCOPe 2.03
  
• d3ftza1 appears in SCOPe 2.04
  
• d3ftza1 appears in SCOPe 2.06
  
• d3ftza1 appears in the current release, SCOPe 2.08