Lineage for d2virb2 (2vir B:121-221)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221536Species Fab HC19 (mouse), lambda L chain [49001] (4 PDB entries)
  8. 221544Domain d2virb2: 2vir B:121-221 [21011]
    Other proteins in same PDB: d2vira1, d2virb1, d2virc_
    complexed with zn
    CA-atoms only

Details for d2virb2

PDB Entry: 2vir (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d2virb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2virb2 b.1.1.2 (B:121-221) Immunoglobulin (constant domains of L and H chains) {Fab HC19 (mouse), lambda L chain}
ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d2virb2:

Click to download the PDB-style file with coordinates for d2virb2.
(The format of our PDB-style files is described here.)

Timeline for d2virb2: