Lineage for d3ftsa1 (3fts A:4-208)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2085522Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2085523Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2085524Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)
  6. 2085540Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 2085541Species Human (Homo sapiens) [TaxId:9606] [63740] (56 PDB entries)
    Uniprot P09960
  8. 2085584Domain d3ftsa1: 3fts A:4-208 [210097]
    Other proteins in same PDB: d3ftsa2, d3ftsa3
    automated match to d1hs6a2
    complexed with act, imd, stl, yb, zn

Details for d3ftsa1

PDB Entry: 3fts (more details), 2.33 Å

PDB Description: leukotriene a4 hydrolase in complex with resveratrol
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3ftsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ftsa1 b.98.1.1 (A:4-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek
vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt
sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped
psrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d3ftsa1:

Click to download the PDB-style file with coordinates for d3ftsa1.
(The format of our PDB-style files is described here.)

Timeline for d3ftsa1: