Lineage for d3fsue_ (3fsu E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089931Superfamily c.1.23: FAD-linked oxidoreductase [51730] (2 families) (S)
    distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation
  5. 2089932Family c.1.23.1: Methylenetetrahydrofolate reductase [51731] (2 protein domains)
    automatically mapped to Pfam PF02219
  6. 2089958Protein automated matches [193645] (3 species)
    not a true protein
  7. 2089959Species Escherichia coli K-12 [TaxId:83333] [225710] (2 PDB entries)
  8. 2089965Domain d3fsue_: 3fsu E: [210092]
    automated match to d1b5tb_
    complexed with c2f, fad, mry, so4; mutant

Details for d3fsue_

PDB Entry: 3fsu (more details), 1.7 Å

PDB Description: Crystal Structure of Escherichia coli Methylenetetrahydrofolate Reductase Double Mutant Phe223LeuGlu28Gln complexed with methyltetrahydrofolate
PDB Compounds: (E:) 5,10-Methylenetetrahydrofolate reductase

SCOPe Domain Sequences for d3fsue_:

Sequence, based on SEQRES records: (download)

>d3fsue_ c.1.23.1 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ffhasqrdalnqslaevqgqinvsfqffpprtsemeqtlwnsidrlsslkpkfvsvtyga
nsgerdrthsiikgikdrtgleaaphltcidatpdelrtiardywnngirhivalrgdlp
pgsgkpemyasdlvtllkevadfdisvaaypevhpeaksaqadllnlkrkvdaganrait
qfffdvesylrfrdrcvsagidveiipgilpvsnfkqakkladmtnvripawmaqmfdgl
dddaetrklvganiamdmvkilsregvkdfhfytlnraemsyaichtlgvrp

Sequence, based on observed residues (ATOM records): (download)

>d3fsue_ c.1.23.1 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ffhasqrdalnqslaevqgqinvsfqffpprtsemeqtlwnsidrlsslkpkfvsvtyth
siikgikdrtgleaaphltcidatpdelrtiardywnngirhivalrgdlppemyasdlv
tllkevadfdisvaaypevhpeaksaqadllnlkrkvdaganraitqfffdvesylrfrd
rcvsagidveiipgilpvsnfkqakkladmtnvripawmaqmfdgldddaetrklvgani
amdmvkilsregvkdfhfytlnraemsyaichtlgvrp

SCOPe Domain Coordinates for d3fsue_:

Click to download the PDB-style file with coordinates for d3fsue_.
(The format of our PDB-style files is described here.)

Timeline for d3fsue_: