SCOPe 2.04: Domain d3fsjx1: 3fsj X:2-181

Lineage for d3fsjx1 (3fsj X:2-181)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
   automatically mapped to Pfam PF02776

6. Protein Benzoylformate decarboxylase [88731] (1 species)

7. Species Pseudomonas putida [TaxId:303] [88732] (7 PDB entries)
   Uniprot P20906

8. Domain d3fsjx1: 3fsj X:2-181 [210084]
   Other proteins in same PDB: d3fsjx2, d3fsjx3
   automated match to d1mcza2
   complexed with ca, d7k

Details for d3fsjx1

PDB Entry: 3fsj, 1.37 Å

PDB Description: Crystal structure of benzoylformate decarboxylase in complex with the inhibitor MBP

PDB Compounds: (X:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d3fsjx1:

Sequence; same for both SEQRES and ATOM records:

>d3fsjx1 c.36.1.5 (X:2-181) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

Timeline for d3fsjx1:

• d3fsjx1 first appeared in SCOPe 2.03
  
• d3fsjx1 appears in SCOPe 2.05
  
• d3fsjx1 appears in the current release, SCOPe 2.08