Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (75 species) not a true protein |
Species Brucella melitensis [TaxId:29459] [225591] (1 PDB entry) |
Domain d3fs2a_: 3fs2 A: [210082] automated match to d3unda_ complexed with pg4, po4 |
PDB Entry: 3fs2 (more details), 1.85 Å
SCOPe Domain Sequences for d3fs2a_:
Sequence, based on SEQRES records: (download)
>d3fs2a_ c.1.10.0 (A:) automated matches {Brucella melitensis [TaxId: 29459]} tanstvkvgnvtfsnsaplaliagpcqmetrdhafemagrlkemtdklgiglvykssfdk anrtslkaargiglekalevfsdlkkeygfpvltdihteeqcaavapvvdvlqipaflcr qtdlliaaartgrvvnvkkgqflapwdmknvlakitesgnpnvlatergvsfgyntlvsd mralpimaglgapvifdathsvqqpggqggstggqrefvetlaraavavgvagffiethe dpdnapsdgpnmvpidkmpalleklmafdriakal
>d3fs2a_ c.1.10.0 (A:) automated matches {Brucella melitensis [TaxId: 29459]} tanstvkvgnvtfsnsaplaliagpcqmetrdhafemagrlkemtdklgiglvykssfdk aniglekalevfsdlkkeygfpvltdihteeqcaavapvvdvlqipaflcrqtdlliaaa rtgrvvnvkkgqflapwdmknvlakitesgnpnvlatergvsfgyntlvsdmralpimag lgapvifdathsvqqpgqrefvetlaraavavgvagffiethedpdnapsdgpnmvpidk mpalleklmafdriakal
Timeline for d3fs2a_: