Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Pf GST [102442] (1 species) cannot be assigned to any of the known GST classes |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102443] (6 PDB entries) |
Domain d3frcb1: 3frc B:4-85 [210080] Other proteins in same PDB: d3frca2, d3frcb2 automated match to d1okta2 complexed with 0hg |
PDB Entry: 3frc (more details), 2 Å
SCOPe Domain Sequences for d3frcb1:
Sequence, based on SEQRES records: (download)
>d3frcb1 c.47.1.5 (B:4-85) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} nivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpilq igdlilaqsqaivrylskkyni
>d3frcb1 c.47.1.5 (B:4-85) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} nivlyyfdargkaelirlifaylgieytdkrfgvgdafvefknfkkekdtpfeqvpilqi gdlilaqsqaivrylskkyni
Timeline for d3frcb1: