SCOPe 2.08: Domain d3fr9a1: 3fr9 A:1-85

Lineage for d3fr9a1 (3fr9 A:1-85)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Pf GST [102442] (1 species)
   cannot be assigned to any of the known GST classes

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102443] (6 PDB entries)

8. Domain d3fr9a1: 3fr9 A:1-85 [210074]
   Other proteins in same PDB: d3fr9a2, d3fr9b2
   automated match to d1okta2
   complexed with cl, gsh

Details for d3fr9a1

PDB Entry: 3fr9, 2.4 Å

PDB Description: Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3fr9a1:

Sequence; same for both SEQRES and ATOM records:

>d3fr9a1 c.47.1.5 (A:1-85) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
ilqigdlilaqsqaivrylskkyni

Timeline for d3fr9a1:

• d3fr9a1 first appeared in SCOPe 2.03
  
• d3fr9a1 appears in SCOPe 2.07