![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (3 proteins) |
![]() | Protein automated matches [227000] (2 species) not a true protein |
![]() | Species Oryza sativa [TaxId:39947] [225644] (2 PDB entries) |
![]() | Domain d3fr8b2: 3fr8 B:308-593 [210073] Other proteins in same PDB: d3fr8a1, d3fr8b1 automated match to d1qmga1 complexed with mg, ndp, pe4, peg, so4 |
PDB Entry: 3fr8 (more details), 2.8 Å
SCOPe Domain Sequences for d3fr8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fr8b2 a.100.1.2 (B:308-593) automated matches {Oryza sativa [TaxId: 39947]} leqeyksdifgergillgavhgivealfrryteqgmdeemaykntvegitgiisktiskk gmlevynslteegkkefnkaysasfypcmdilyecyedvasgseirsvvlagrrfyekeg lpafpmgnidqtrmwkvgekvrstrpendlgplhpftagvyvalmmaqievlrkkghsys eiinesviesvdslnpfmhargvafmvdncsttarlgsrkwaprfdyiltqqafvtvdkd apinqdlisnfmsdpvhgaievcaelrptvdisvpanadfvrpelr
Timeline for d3fr8b2: