Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (159 species) not a true protein |
Species Oryza sativa [TaxId:39947] [225643] (2 PDB entries) |
Domain d3fr8b1: 3fr8 B:77-307 [210072] Other proteins in same PDB: d3fr8a2, d3fr8b2 automated match to d1qmga2 complexed with mg, ndp, pe4, peg, so4 |
PDB Entry: 3fr8 (more details), 2.8 Å
SCOPe Domain Sequences for d3fr8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fr8b1 c.2.1.0 (B:77-307) automated matches {Oryza sativa [TaxId: 39947]} pavgaampsldfdtsvfnkekvslagheeyivrggrnlfpllpeafkgikqigvigwgsq gpaqaqnlrdslaeaksdivvkiglrkgsksfdearaagfteesgtlgdiwetvsgsdlv lllisdaaqadnyekifshmkpnsilglshgfllghlqsagldfpknisviavcpkgmgp svrrlyvqgkeingaginssfavhqdvdgratdvalgwsvalgspftfatt
Timeline for d3fr8b1: