SCOPe 2.03: Domain d3fr8b1: 3fr8 B:77-307

Lineage for d3fr8b1 (3fr8 B:77-307)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [225643] (2 PDB entries)

8. Domain d3fr8b1: 3fr8 B:77-307 [210072]
   Other proteins in same PDB: d3fr8a2, d3fr8b2
   automated match to d1qmga2
   complexed with mg, ndp, pe4, peg, so4

Details for d3fr8b1

PDB Entry: 3fr8, 2.8 Å

PDB Description: rice Ketolacid reductoisomerase in complex with Mg2+-NADPH

PDB Compounds: (B:) Putative ketol-acid reductoisomerase (Os05g0573700 protein)

SCOPe Domain Sequences for d3fr8b1:

Sequence; same for both SEQRES and ATOM records:

>d3fr8b1 c.2.1.0 (B:77-307) automated matches {Oryza sativa [TaxId: 39947]}
pavgaampsldfdtsvfnkekvslagheeyivrggrnlfpllpeafkgikqigvigwgsq
gpaqaqnlrdslaeaksdivvkiglrkgsksfdearaagfteesgtlgdiwetvsgsdlv
lllisdaaqadnyekifshmkpnsilglshgfllghlqsagldfpknisviavcpkgmgp
svrrlyvqgkeingaginssfavhqdvdgratdvalgwsvalgspftfatt

Timeline for d3fr8b1:

• d3fr8b1 is new in SCOPe 2.03-stable
  
• d3fr8b1 appears in SCOPe 2.04
  
• d3fr8b1 appears in the current release, SCOPe 2.08