Lineage for d3fr7b2 (3fr7 B:1308-1575)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721358Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (3 proteins)
  6. 2721375Protein automated matches [227000] (2 species)
    not a true protein
  7. 2721381Species Oryza sativa [TaxId:39947] [225644] (2 PDB entries)
  8. 2721383Domain d3fr7b2: 3fr7 B:1308-1575 [210069]
    Other proteins in same PDB: d3fr7a1, d3fr7b1
    automated match to d1qmga1
    complexed with mg

Details for d3fr7b2

PDB Entry: 3fr7 (more details), 1.55 Å

PDB Description: ketol-acid reductoisomerase (KARI) in complex with Mg2+
PDB Compounds: (B:) Putative ketol-acid reductoisomerase (Os05g0573700 protein)

SCOPe Domain Sequences for d3fr7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fr7b2 a.100.1.2 (B:1308-1575) automated matches {Oryza sativa [TaxId: 39947]}
leqeyksdifgergillgavhgivealfrryteqgmdeemaykntvegitgiisktiskk
gmlevynslteegkkefnkaysasfypcmdilyecyedvasgseirsvvlagrrfyekeg
lpafpmgnidqtrmwkvgekvrstrpendlgplhpftagvyvalmmaqievlrkkghsys
eiinesviesvdslnpfmhargvafmvdncsttarlgsrkwaprfdyiltqqafvtvdkd
apinqdlisnfmsdpvhgaievcaelrp

SCOPe Domain Coordinates for d3fr7b2:

Click to download the PDB-style file with coordinates for d3fr7b2.
(The format of our PDB-style files is described here.)

Timeline for d3fr7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fr7b1