| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (3 proteins) |
| Protein automated matches [227000] (2 species) not a true protein |
| Species Oryza sativa [TaxId:39947] [225644] (2 PDB entries) |
| Domain d3fr7b2: 3fr7 B:1308-1575 [210069] Other proteins in same PDB: d3fr7a1, d3fr7b1 automated match to d1qmga1 complexed with mg |
PDB Entry: 3fr7 (more details), 1.55 Å
SCOPe Domain Sequences for d3fr7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fr7b2 a.100.1.2 (B:1308-1575) automated matches {Oryza sativa [TaxId: 39947]}
leqeyksdifgergillgavhgivealfrryteqgmdeemaykntvegitgiisktiskk
gmlevynslteegkkefnkaysasfypcmdilyecyedvasgseirsvvlagrrfyekeg
lpafpmgnidqtrmwkvgekvrstrpendlgplhpftagvyvalmmaqievlrkkghsys
eiinesviesvdslnpfmhargvafmvdncsttarlgsrkwaprfdyiltqqafvtvdkd
apinqdlisnfmsdpvhgaievcaelrp
Timeline for d3fr7b2: