Lineage for d3fr7b1 (3fr7 B:1086-1307)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847936Species Oryza sativa [TaxId:39947] [225643] (2 PDB entries)
  8. 2847938Domain d3fr7b1: 3fr7 B:1086-1307 [210068]
    Other proteins in same PDB: d3fr7a2, d3fr7b2
    automated match to d1qmga2
    complexed with mg

Details for d3fr7b1

PDB Entry: 3fr7 (more details), 1.55 Å

PDB Description: ketol-acid reductoisomerase (KARI) in complex with Mg2+
PDB Compounds: (B:) Putative ketol-acid reductoisomerase (Os05g0573700 protein)

SCOPe Domain Sequences for d3fr7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fr7b1 c.2.1.0 (B:1086-1307) automated matches {Oryza sativa [TaxId: 39947]}
ldfdtsvfnkekvslagheeyivrggrnlfpllpeafkgikqigvigwgsqgpaqaqnlr
dslaeaksdivvkiglrkgsksfdearaagfteesgtlgdiwetvsgsdlvlllisdaaq
adnyekifshmkpnsilglshgfllghlqsagldfpknisviavcpkgmgpsvrrlyvqg
keingaginssfavhqdvdgratdvalgwsvalgspftfatt

SCOPe Domain Coordinates for d3fr7b1:

Click to download the PDB-style file with coordinates for d3fr7b1.
(The format of our PDB-style files is described here.)

Timeline for d3fr7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fr7b2