![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (319 species) not a true protein |
![]() | Species Oryza sativa [TaxId:39947] [225643] (2 PDB entries) |
![]() | Domain d3fr7b1: 3fr7 B:1086-1307 [210068] Other proteins in same PDB: d3fr7a2, d3fr7b2 automated match to d1qmga2 complexed with mg |
PDB Entry: 3fr7 (more details), 1.55 Å
SCOPe Domain Sequences for d3fr7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fr7b1 c.2.1.0 (B:1086-1307) automated matches {Oryza sativa [TaxId: 39947]} ldfdtsvfnkekvslagheeyivrggrnlfpllpeafkgikqigvigwgsqgpaqaqnlr dslaeaksdivvkiglrkgsksfdearaagfteesgtlgdiwetvsgsdlvlllisdaaq adnyekifshmkpnsilglshgfllghlqsagldfpknisviavcpkgmgpsvrrlyvqg keingaginssfavhqdvdgratdvalgwsvalgspftfatt
Timeline for d3fr7b1: