Lineage for d3fr7a2 (3fr7 A:308-580)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276308Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1276309Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1276340Family a.100.1.2: Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) [48184] (3 proteins)
  6. 1276357Protein automated matches [227000] (1 species)
    not a true protein
  7. 1276358Species Oryza sativa [TaxId:39947] [225644] (2 PDB entries)
  8. 1276359Domain d3fr7a2: 3fr7 A:308-580 [210067]
    Other proteins in same PDB: d3fr7a1, d3fr7b1
    automated match to d1qmga1
    complexed with mg

Details for d3fr7a2

PDB Entry: 3fr7 (more details), 1.55 Å

PDB Description: ketol-acid reductoisomerase (KARI) in complex with Mg2+
PDB Compounds: (A:) Putative ketol-acid reductoisomerase (Os05g0573700 protein)

SCOPe Domain Sequences for d3fr7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fr7a2 a.100.1.2 (A:308-580) automated matches {Oryza sativa [TaxId: 39947]}
leqeyksdifgergillgavhgivealfrryteqgmdeemaykntvegitgiisktiskk
gmlevynslteegkkefnkaysasfypcmdilyecyedvasgseirsvvlagrrfyekeg
lpafpmgnidqtrmwkvgekvrstrpendlgplhpftagvyvalmmaqievlrkkghsys
eiinesviesvdslnpfmhargvafmvdncsttarlgsrkwaprfdyiltqqafvtvdkd
apinqdlisnfmsdpvhgaievcaelrptvdis

SCOPe Domain Coordinates for d3fr7a2:

Click to download the PDB-style file with coordinates for d3fr7a2.
(The format of our PDB-style files is described here.)

Timeline for d3fr7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fr7a1