![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein automated matches [226848] (14 species) not a true protein |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [225818] (3 PDB entries) |
![]() | Domain d3fr6b2: 3fr6 B:86-206 [210065] Other proteins in same PDB: d3fr6a1, d3fr6b1 automated match to d1pa3a1 complexed with mg |
PDB Entry: 3fr6 (more details), 2.6 Å
SCOPe Domain Sequences for d3fr6b2:
Sequence, based on SEQRES records: (download)
>d3fr6b2 a.45.1.1 (B:86-206) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} cgeselnefyadmifcgvqdihykfnntnlfkanettflnedlpkwsgyfekllkknhtn nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn r
>d3fr6b2 a.45.1.1 (B:86-206) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} cgeselnefyadmifcgvqdihykfnntnlfkanettflnedlpkwsgyfekllkknhtn yyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitnr
Timeline for d3fr6b2: