Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein automated matches [227019] (4 species) not a true protein |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [225817] (3 PDB entries) |
Domain d3fr3b1: 3fr3 B:4-85 [210060] Other proteins in same PDB: d3fr3a2, d3fr3b2 automated match to d1pa3a2 complexed with gds |
PDB Entry: 3fr3 (more details), 1.9 Å
SCOPe Domain Sequences for d3fr3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fr3b1 c.47.1.5 (B:4-85) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} nivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpilq igdlilaqsqaivrylskkyni
Timeline for d3fr3b1: