Lineage for d2visa2 (2vis A:111-210)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 290004Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 290069Species Mouse (Mus musculus) [TaxId:10090] [88571] (20 PDB entries)
  8. 290089Domain d2visa2: 2vis A:111-210 [21006]
    Other proteins in same PDB: d2visa1, d2visb1, d2visb2, d2visc_
    part of Fab HC19
    complexed with nag, zn; mutant

Details for d2visa2

PDB Entry: 2vis (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin, (escape) mutant with thr 131 replaced by ile, complexed with a neutralizing antibody

SCOP Domain Sequences for d2visa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2visa2 b.1.1.2 (A:111-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtveksls

SCOP Domain Coordinates for d2visa2:

Click to download the PDB-style file with coordinates for d2visa2.
(The format of our PDB-style files is described here.)

Timeline for d2visa2: