SCOP 1.63: Domain d2visa2: 2vis A:111-210

Lineage for d2visa2 (2vis A:111-210)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab HC19 (mouse), lambda L chain [49001] (4 PDB entries)

8. Domain d2visa2: 2vis A:111-210 [21006]
   Other proteins in same PDB: d2visa1, d2visb1, d2visc_

Details for d2visa2

PDB Entry: 2vis, 3.25 Å

PDB Description: influenza virus hemagglutinin, (escape) mutant with thr 131 replaced by ile, complexed with a neutralizing antibody

SCOP Domain Sequences for d2visa2:

Sequence; same for both SEQRES and ATOM records:

>d2visa2 b.1.1.2 (A:111-210) Immunoglobulin (constant domains of L and H chains) {Fab HC19 (mouse), lambda L chain}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtveksls

Timeline for d2visa2:

• d2visa2 first appeared (with stable ids) in SCOP 1.55
  
• d2visa2 appears in SCOP 1.61
  
• d2visa2 appears in SCOP 1.65
  
• d2visa2 appears in the current release, SCOPe 2.08