Lineage for d2visa2 (2vis A:111-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749548Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2749634Species Mouse (Mus musculus) [TaxId:10090] [88571] (22 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 2749655Domain d2visa2: 2vis A:111-210 [21006]
    Other proteins in same PDB: d2visa1, d2visb1, d2visb2, d2visc_
    part of Fab HC19
    complexed with nag, zn; mutant

Details for d2visa2

PDB Entry: 2vis (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin, (escape) mutant with thr 131 replaced by ile, complexed with a neutralizing antibody
PDB Compounds: (A:) immunoglobulin (igg1, lambda)

SCOPe Domain Sequences for d2visa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2visa2 b.1.1.2 (A:111-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtveksls

SCOPe Domain Coordinates for d2visa2:

Click to download the PDB-style file with coordinates for d2visa2.
(The format of our PDB-style files is described here.)

Timeline for d2visa2: