| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein automated matches [226848] (14 species) not a true protein |
| Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [225818] (3 PDB entries) |
| Domain d3fr3a2: 3fr3 A:86-204 [210059] Other proteins in same PDB: d3fr3a1, d3fr3b1 automated match to d1pa3a1 complexed with gds |
PDB Entry: 3fr3 (more details), 1.9 Å
SCOPe Domain Sequences for d3fr3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fr3a2 a.45.1.1 (A:86-204) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntaanettflnedlpkwsgyfekllkknhtnnnn
dkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitnrk
Timeline for d3fr3a2: