SCOPe 2.08: Domain d3fr3a2: 3fr3 A:86-204

Lineage for d3fr3a2 (3fr3 A:86-204)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (14 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [225818] (3 PDB entries)

8. Domain d3fr3a2: 3fr3 A:86-204 [210059]
   Other proteins in same PDB: d3fr3a1, d3fr3b1
   automated match to d1pa3a1
   complexed with gds

Details for d3fr3a2

PDB Entry: 3fr3, 1.9 Å

PDB Description: Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3fr3a2:

Sequence; same for both SEQRES and ATOM records:

>d3fr3a2 a.45.1.1 (A:86-204) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntaanettflnedlpkwsgyfekllkknhtnnnn
dkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitnrk

Timeline for d3fr3a2:

• d3fr3a2 first appeared in SCOPe 2.03
  
• d3fr3a2 appears in SCOPe 2.07