Lineage for d3fr3a2 (3fr3 A:86-204)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713701Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [225818] (3 PDB entries)
  8. 2713702Domain d3fr3a2: 3fr3 A:86-204 [210059]
    Other proteins in same PDB: d3fr3a1, d3fr3b1
    automated match to d1pa3a1
    complexed with gds

Details for d3fr3a2

PDB Entry: 3fr3 (more details), 1.9 Å

PDB Description: Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3fr3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fr3a2 a.45.1.1 (A:86-204) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntaanettflnedlpkwsgyfekllkknhtnnnn
dkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitnrk

SCOPe Domain Coordinates for d3fr3a2:

Click to download the PDB-style file with coordinates for d3fr3a2.
(The format of our PDB-style files is described here.)

Timeline for d3fr3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fr3a1