Lineage for d3fq3c_ (3fq3 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1789893Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 1790027Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 1790028Protein automated matches [190523] (11 species)
    not a true protein
  7. 1790039Species Brucella melitensis [TaxId:359391] [225590] (1 PDB entry)
  8. 1790042Domain d3fq3c_: 3fq3 C: [210046]
    automated match to d3sw5f_
    complexed with po4

Details for d3fq3c_

PDB Entry: 3fq3 (more details), 1.9 Å

PDB Description: Crystal structure of inorganic phosphatase from brucella melitensis
PDB Compounds: (C:) Inorganic pyrophosphatase:Bacterial/Archaeal inorganic pyrophosphatase

SCOPe Domain Sequences for d3fq3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fq3c_ b.40.5.0 (C:) automated matches {Brucella melitensis [TaxId: 359391]}
nidaisigsnppedvnviievpvggqpikyemdkkagalivdrflytpmtypgnygfvph
tlsedgdpidvlvcntrplipgcvinvrpigvlvmednsgkdekiiavpsphltrryeki
hdytdmpeitlkqiahffehykdlepgkwvkigdwgdedyarkfiveaierak

SCOPe Domain Coordinates for d3fq3c_:

Click to download the PDB-style file with coordinates for d3fq3c_.
(The format of our PDB-style files is described here.)

Timeline for d3fq3c_: