Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.0: automated matches [191399] (1 protein) not a true family |
Protein automated matches [190523] (11 species) not a true protein |
Species Brucella melitensis [TaxId:359391] [225590] (1 PDB entry) |
Domain d3fq3c_: 3fq3 C: [210046] automated match to d3sw5f_ complexed with po4 |
PDB Entry: 3fq3 (more details), 1.9 Å
SCOPe Domain Sequences for d3fq3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fq3c_ b.40.5.0 (C:) automated matches {Brucella melitensis [TaxId: 359391]} nidaisigsnppedvnviievpvggqpikyemdkkagalivdrflytpmtypgnygfvph tlsedgdpidvlvcntrplipgcvinvrpigvlvmednsgkdekiiavpsphltrryeki hdytdmpeitlkqiahffehykdlepgkwvkigdwgdedyarkfiveaierak
Timeline for d3fq3c_: