Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.1: Reductases [52344] (5 proteins) |
Protein automated matches [226995] (5 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [225605] (1 PDB entry) |
Domain d3fpkb2: 3fpk B:101-248 [210043] Other proteins in same PDB: d3fpka1, d3fpkb1 automated match to d1fdra2 complexed with ca, fad, mg |
PDB Entry: 3fpk (more details), 1.7 Å
SCOPe Domain Sequences for d3fpkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fpkb2 c.25.1.1 (B:101-248) automated matches {Salmonella typhimurium [TaxId: 99287]} devpdcetlwmlatgtaigpylsilqygqdvarfknlvlvhaarfaadlsylplmlelqq ryegklriqtvvsrenvpgsltgrvpaliengelekavglpmdketshvmlcgnpqmvrd tqqllketrqmtkhlrrrpghmtaehyw
Timeline for d3fpkb2: