SCOPe 2.05: Domain d3fpka2: 3fpk A:101-248

Lineage for d3fpka2 (3fpk A:101-248)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein automated matches [226995] (7 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [225605] (1 PDB entry)

8. Domain d3fpka2: 3fpk A:101-248 [210041]
   Other proteins in same PDB: d3fpka1, d3fpkb1
   automated match to d1fdra2
   complexed with ca, fad, mg

Details for d3fpka2

PDB Entry: 3fpk, 1.7 Å

PDB Description: Crystal Structure of Ferredoxin-NADP Reductase from Salmonella typhimurium

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d3fpka2:

Sequence; same for both SEQRES and ATOM records:

>d3fpka2 c.25.1.1 (A:101-248) automated matches {Salmonella typhimurium [TaxId: 99287]}
devpdcetlwmlatgtaigpylsilqygqdvarfknlvlvhaarfaadlsylplmlelqq
ryegklriqtvvsrenvpgsltgrvpaliengelekavglpmdketshvmlcgnpqmvrd
tqqllketrqmtkhlrrrpghmtaehyw

Timeline for d3fpka2:

• d3fpka2 first appeared in SCOPe 2.03
  
• d3fpka2 appears in SCOPe 2.04
  
• d3fpka2 appears in SCOPe 2.06
  
• d3fpka2 appears in the current release, SCOPe 2.08