| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88571] (22 PDB entries) Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3) |
| Domain d1gigl2: 1gig L:111-210 [21004] Other proteins in same PDB: d1gigh1, d1gigh2, d1gigl1 part of Fab HC19 |
PDB Entry: 1gig (more details), 2.3 Å
SCOPe Domain Sequences for d1gigl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gigl2 b.1.1.2 (L:111-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtveksls
Timeline for d1gigl2: