SCOPe 2.05: Domain d3fpdb_: 3fpd B:

Lineage for d3fpdb_ (3fpd B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.7: SET domain [82199] (4 families)
   duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
   also contains a substrate-binding alpha+beta subdomain inserted in the core

5. Family b.85.7.0: automated matches [227191] (1 protein)
   not a true family

6. Protein automated matches [226914] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225158] (11 PDB entries)

8. Domain d3fpdb_: 3fpd B: [210039]
   automated match to d1pega_
   complexed with q4a, sah, zn

Details for d3fpdb_

PDB Entry: 3fpd, 2.4 Å

PDB Description: G9a-like protein lysine methyltransferase inhibition by BIX-01294

PDB Compounds: (B:) Histone-lysine N-methyltransferase, H3 lysine-9 specific 5

SCOPe Domain Sequences for d3fpdb_:

Sequence; same for both SEQRES and ATOM records:

>d3fpdb_ b.85.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erivsrdiargyeripipcvnavdsepcpsnykyvsqncvtspmnidrnithlqycvcid
dcsssncmcgqlsmrcwydkdgrllpefnmaepplifecnhacscwrncrnrvvqnglra
rlqlyrtrdmgwgvrslqdippgtfvceyvgelisdseadvreedsylfdldnkdgevyc
idarfygnvsrfinhhcepnlvpvrvfmahqdlrfpriaffstrlieageqlgfdygerf
wdikgklfscrcgspkcrhs

Timeline for d3fpdb_:

• d3fpdb_ first appeared in SCOPe 2.03
  
• d3fpdb_ appears in SCOPe 2.04
  
• d3fpdb_ appears in SCOPe 2.06
  
• d3fpdb_ appears in the current release, SCOPe 2.08